Lineage for d2eijv1 (2eij V:1-73)

  1. Root: SCOP 1.75
  2. 886031Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)
  3. 887128Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 887193Superfamily f.23.3: Mitochondrial cytochrome c oxidase subunit VIc [81415] (1 family) (S)
  5. 887194Family f.23.3.1: Mitochondrial cytochrome c oxidase subunit VIc [81414] (1 protein)
  6. 887195Protein Mitochondrial cytochrome c oxidase subunit VIc [81413] (1 species)
    function unknown, probably acts as a regulator or is required for the assembly
  7. 887196Species Cow (Bos taurus) [TaxId:9913] [81412] (14 PDB entries)
  8. 887204Domain d2eijv1: 2eij V:1-73 [132162]
    Other proteins in same PDB: d2eija1, d2eijb1, d2eijb2, d2eijc1, d2eijd1, d2eije1, d2eijf1, d2eijg1, d2eijh1, d2eijj1, d2eijk1, d2eijl1, d2eijm1, d2eijn1, d2eijo1, d2eijo2, d2eijp1, d2eijq1, d2eijr1, d2eijs1, d2eijt1, d2eiju1, d2eijw1, d2eijx1, d2eijy1, d2eijz1
    automatically matched to d1occi_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d2eijv1

PDB Entry: 2eij (more details), 1.9 Å

PDB Description: Bovine heart cytochrome C oxidase in the fully reduced state
PDB Compounds: (V:) Cytochrome c oxidase polypeptide VIc

SCOP Domain Sequences for d2eijv1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eijv1 f.23.3.1 (V:1-73) Mitochondrial cytochrome c oxidase subunit VIc {Cow (Bos taurus) [TaxId: 9913]}
stalakpqmrgllarrlrfhivgafmvslgfatfykfavaekrkkayadfyrnydsmkdf
eemrkagifqsak

SCOP Domain Coordinates for d2eijv1:

Click to download the PDB-style file with coordinates for d2eijv1.
(The format of our PDB-style files is described here.)

Timeline for d2eijv1: