Lineage for d2eijo2 (2eij O:1-90)

  1. Root: SCOP 1.75
  2. 886031Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)
  3. 886795Fold f.17: Transmembrane helix hairpin [81334] (5 superfamilies)
    two antiparallel transmembrane helices
  4. 886817Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (1 family) (S)
  5. 886818Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (4 proteins)
  6. 886844Protein Mitochondrial cytochrome c oxidase, subunit II [81455] (1 species)
  7. 886845Species Cow (Bos taurus) [TaxId:9913] [81454] (14 PDB entries)
  8. 886853Domain d2eijo2: 2eij O:1-90 [132155]
    Other proteins in same PDB: d2eija1, d2eijb1, d2eijc1, d2eijd1, d2eije1, d2eijf1, d2eijg1, d2eijh1, d2eiji1, d2eijj1, d2eijk1, d2eijl1, d2eijm1, d2eijn1, d2eijo1, d2eijp1, d2eijq1, d2eijr1, d2eijs1, d2eijt1, d2eiju1, d2eijv1, d2eijw1, d2eijx1, d2eijy1, d2eijz1
    automatically matched to d1occb2
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d2eijo2

PDB Entry: 2eij (more details), 1.9 Å

PDB Description: Bovine heart cytochrome C oxidase in the fully reduced state
PDB Compounds: (O:) Cytochrome c oxidase subunit 2

SCOP Domain Sequences for d2eijo2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eijo2 f.17.2.1 (O:1-90) Mitochondrial cytochrome c oxidase, subunit II {Cow (Bos taurus) [TaxId: 9913]}
maypmqlgfqdatspimeellhfhdhtlmivflisslvlyiislmlttklthtstmdaqe
vetiwtilpaiililialpslrilymmdei

SCOP Domain Coordinates for d2eijo2:

Click to download the PDB-style file with coordinates for d2eijo2.
(The format of our PDB-style files is described here.)

Timeline for d2eijo2: