Lineage for d2eijk1 (2eij K:6-54)

  1. Root: SCOP 1.73
  2. 744527Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)
  3. 745533Fold f.23: Single transmembrane helix [81407] (30 superfamilies)
    not a true fold
  4. 745662Superfamily f.23.5: Mitochondrial cytochrome c oxidase subunit VIIb [81423] (1 family) (S)
  5. 745663Family f.23.5.1: Mitochondrial cytochrome c oxidase subunit VIIb [81422] (1 protein)
  6. 745664Protein Mitochondrial cytochrome c oxidase subunit VIIb [81421] (1 species)
    function unknown, probably acts as a regulator or is required for the assembly
  7. 745665Species Cow (Bos taurus) [TaxId:9913] [81420] (14 PDB entries)
  8. 745672Domain d2eijk1: 2eij K:6-54 [132150]
    Other proteins in same PDB: d2eija1, d2eijb1, d2eijb2, d2eijc1, d2eijd1, d2eije1, d2eijf1, d2eijg1, d2eijh1, d2eiji1, d2eijj1, d2eijl1, d2eijm1, d2eijn1, d2eijo1, d2eijo2, d2eijp1, d2eijq1, d2eijr1, d2eijs1, d2eijt1, d2eiju1, d2eijv1, d2eijw1, d2eijy1, d2eijz1
    automatically matched to d1occk_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d2eijk1

PDB Entry: 2eij (more details), 1.9 Å

PDB Description: Bovine heart cytochrome C oxidase in the fully reduced state
PDB Compounds: (K:) Cytochrome c oxidase polypeptide VIIb

SCOP Domain Sequences for d2eijk1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eijk1 f.23.5.1 (K:6-54) Mitochondrial cytochrome c oxidase subunit VIIb {Cow (Bos taurus) [TaxId: 9913]}
apdfhdkygnavlasgatfcvavwvymatqigiewnpspvgrvtpkewr

SCOP Domain Coordinates for d2eijk1:

Click to download the PDB-style file with coordinates for d2eijk1.
(The format of our PDB-style files is described here.)

Timeline for d2eijk1: