Lineage for d2eijh1 (2eij H:7-85)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 770504Fold a.51: Cytochrome c oxidase subunit h [47693] (1 superfamily)
    4 helices; irregular array, disulfide-linked
  4. 770505Superfamily a.51.1: Cytochrome c oxidase subunit h [47694] (1 family) (S)
  5. 770506Family a.51.1.1: Cytochrome c oxidase subunit h [47695] (1 protein)
  6. 770507Protein Cytochrome c oxidase subunit h [47696] (1 species)
  7. 770508Species Cow (Bos taurus) [TaxId:9913] [47697] (14 PDB entries)
  8. 770515Domain d2eijh1: 2eij H:7-85 [132147]
    Other proteins in same PDB: d2eija1, d2eijb1, d2eijb2, d2eijc1, d2eijd1, d2eije1, d2eijf1, d2eijg1, d2eiji1, d2eijj1, d2eijk1, d2eijl1, d2eijm1, d2eijn1, d2eijo1, d2eijo2, d2eijp1, d2eijq1, d2eijr1, d2eijs1, d2eijt1, d2eijv1, d2eijw1, d2eijx1, d2eijy1, d2eijz1
    automatically matched to d1ocrh_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d2eijh1

PDB Entry: 2eij (more details), 1.9 Å

PDB Description: Bovine heart cytochrome C oxidase in the fully reduced state
PDB Compounds: (H:) Cytochrome c oxidase subunit VIb isoform 1

SCOP Domain Sequences for d2eijh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eijh1 a.51.1.1 (H:7-85) Cytochrome c oxidase subunit h {Cow (Bos taurus) [TaxId: 9913]}
kiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpi
swvstwddrraegtfpgki

SCOP Domain Coordinates for d2eijh1:

Click to download the PDB-style file with coordinates for d2eijh1.
(The format of our PDB-style files is described here.)

Timeline for d2eijh1: