SCOP 1.73: Domain d2eijh1: 2eij H:7-85

Lineage for d2eijh1 (2eij H:7-85)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.51: Cytochrome c oxidase subunit h [47693] (1 superfamily)
   4 helices; irregular array, disulfide-linked

4. Superfamily a.51.1: Cytochrome c oxidase subunit h [47694] (1 family)

5. Family a.51.1.1: Cytochrome c oxidase subunit h [47695] (1 protein)

6. Protein Cytochrome c oxidase subunit h [47696] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [47697] (14 PDB entries)

8. Domain d2eijh1: 2eij H:7-85 [132147]
   Other proteins in same PDB: d2eija1, d2eijb1, d2eijb2, d2eijc1, d2eijd1, d2eije1, d2eijf1, d2eijg1, d2eiji1, d2eijj1, d2eijk1, d2eijl1, d2eijm1, d2eijn1, d2eijo1, d2eijo2, d2eijp1, d2eijq1, d2eijr1, d2eijs1, d2eijt1, d2eijv1, d2eijw1, d2eijx1, d2eijy1, d2eijz1
   automatically matched to d1ocrh_
   complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d2eijh1

PDB Entry: 2eij, 1.9 Å

PDB Description: Bovine heart cytochrome C oxidase in the fully reduced state

PDB Compounds: (H:) Cytochrome c oxidase subunit VIb isoform 1

SCOP Domain Sequences for d2eijh1:

Sequence; same for both SEQRES and ATOM records:

>d2eijh1 a.51.1.1 (H:7-85) Cytochrome c oxidase subunit h {Cow (Bos taurus) [TaxId: 9913]}
kiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpi
swvstwddrraegtfpgki

Timeline for d2eijh1:

• d2eijh1 is new in SCOP 1.73
  
• d2eijh1 appears in SCOP 1.75
  
• d2eijh1 appears in the current release, SCOPe 2.08, called d2eijh_