SCOPe 2.08: Domain d2eijf_: 2eij F:

Lineage for d2eijf_ (2eij F:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.5: Rubredoxin-like [57802] (4 families)

5. Family g.41.5.3: Cytochrome c oxidase Subunit F [57818] (2 proteins)
   membrane-anchored rubredoxin-like domain
   automatically mapped to Pfam PF01215

6. Protein Cytochrome c oxidase Subunit F [57819] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [57820] (50 PDB entries)

8. Domain d2eijf_: 2eij F: [132145]
   Other proteins in same PDB: d2eija_, d2eijb1, d2eijb2, d2eijc_, d2eijd_, d2eije_, d2eijg_, d2eijh_, d2eiji_, d2eijj_, d2eijk_, d2eijl_, d2eijm_, d2eijn_, d2eijo1, d2eijo2, d2eijp_, d2eijq_, d2eijr_, d2eijt_, d2eiju_, d2eijv_, d2eijw_, d2eijx_, d2eijy_, d2eijz_
   automated match to d1occf_
   complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d2eijf_

PDB Entry: 2eij, 1.9 Å

PDB Description: Bovine heart cytochrome C oxidase in the fully reduced state

PDB Compounds: (F:) Cytochrome c oxidase polypeptide Vb

SCOPe Domain Sequences for d2eijf_:

Sequence; same for both SEQRES and ATOM records:

>d2eijf_ g.41.5.3 (F:) Cytochrome c oxidase Subunit F {Cow (Bos taurus) [TaxId: 9913]}
asgggvptdeeqatglerevmlaarkgqdpynilapkatsgtkedpnlvpsitnkrivgc
iceednstviwfwlhkgeaqrcpscgthyklvphqlah

Timeline for d2eijf_:

• d2eijf_ first appeared in SCOP 1.73, called d2eijf1
  
• d2eijf_ appears in SCOPe 2.07