Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.24: Cytochrome c oxidase subunit I-like [81443] (1 superfamily) 12 transmembrane helices in an approximate threefold rotational symmetric arrangement |
Superfamily f.24.1: Cytochrome c oxidase subunit I-like [81442] (1 family) |
Family f.24.1.1: Cytochrome c oxidase subunit I-like [81441] (5 proteins) the largest and best conserved subunit, contains two heme groups, low spin heme a and high spin heme a3 |
Protein automated matches [190134] (4 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [187061] (16 PDB entries) |
Domain d2eija_: 2eij A: [132139] Other proteins in same PDB: d2eijb1, d2eijb2, d2eijc_, d2eijd_, d2eije_, d2eijf_, d2eijg_, d2eijh_, d2eiji_, d2eijj_, d2eijk_, d2eijl_, d2eijm_, d2eijo1, d2eijo2, d2eijp_, d2eijq_, d2eijr_, d2eijs_, d2eijt_, d2eiju_, d2eijv_, d2eijw_, d2eijx_, d2eijy_, d2eijz_ automated match to d1occa_ complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn |
PDB Entry: 2eij (more details), 1.9 Å
SCOPe Domain Sequences for d2eija_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2eija_ f.24.1.1 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]} mfinrwlfstnhkdigtlyllfgawagmvgtalslliraelgqpgtllgddqiynvvvta hafvmiffmvmpimiggfgnwlvplmigapdmafprmnnmsfwllppsfllllassmvea gagtgwtvypplagnlahagasvdltifslhlagvssilgainfittiinmkppamsqyq tplfvwsvmitavllllslpvlaagitmlltdrnlnttffdpagggdpilyqhlfwffgh pevyililpgfgmishivtyysgkkepfgymgmvwammsigflgfivwahhmftvgmdvd trayftsatmiiaiptgvkvfswlatlhggnikwspammwalgfiflftvggltgivlan ssldivlhdtyyvvahfhyvlsmgavfaimggfvhwfplfsgytlndtwakihfaimfvg vnmtffpqhflglsgmprrysdypdaytmwntissmgsfisltavmlmvfiiweafaskr evltvdltttnlewlngcpppyhtfeeptyvnlk
Timeline for d2eija_:
View in 3D Domains from other chains: (mouse over for more information) d2eijb1, d2eijb2, d2eijc_, d2eijd_, d2eije_, d2eijf_, d2eijg_, d2eijh_, d2eiji_, d2eijj_, d2eijk_, d2eijl_, d2eijm_, d2eijn_, d2eijo1, d2eijo2, d2eijp_, d2eijq_, d2eijr_, d2eijs_, d2eijt_, d2eiju_, d2eijv_, d2eijw_, d2eijx_, d2eijy_, d2eijz_ |