Lineage for d2eija1 (2eij A:1-514)

  1. Root: SCOP 1.75
  2. 886031Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)
  3. 887788Fold f.24: Cytochrome c oxidase subunit I-like [81443] (1 superfamily)
    12 transmembrane helices in an approximate threefold rotational symmetric arrangement
  4. 887789Superfamily f.24.1: Cytochrome c oxidase subunit I-like [81442] (1 family) (S)
  5. 887790Family f.24.1.1: Cytochrome c oxidase subunit I-like [81441] (4 proteins)
    the largest and best conserved subunit, contains two heme groups, low spin heme a and high spin heme a3
  6. 887812Protein Mitochondrial cytochrome c oxidase, subunit I [81433] (1 species)
  7. 887813Species Cow (Bos taurus) [TaxId:9913] [81432] (14 PDB entries)
  8. 887820Domain d2eija1: 2eij A:1-514 [132139]
    Other proteins in same PDB: d2eijb1, d2eijb2, d2eijc1, d2eijd1, d2eije1, d2eijf1, d2eijg1, d2eijh1, d2eiji1, d2eijj1, d2eijk1, d2eijl1, d2eijm1, d2eijo1, d2eijo2, d2eijp1, d2eijq1, d2eijr1, d2eijs1, d2eijt1, d2eiju1, d2eijv1, d2eijw1, d2eijx1, d2eijy1, d2eijz1
    automatically matched to d1occa_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d2eija1

PDB Entry: 2eij (more details), 1.9 Å

PDB Description: Bovine heart cytochrome C oxidase in the fully reduced state
PDB Compounds: (A:) Cytochrome c oxidase subunit 1

SCOP Domain Sequences for d2eija1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eija1 f.24.1.1 (A:1-514) Mitochondrial cytochrome c oxidase, subunit I {Cow (Bos taurus) [TaxId: 9913]}
mfinrwlfstnhkdigtlyllfgawagmvgtalslliraelgqpgtllgddqiynvvvta
hafvmiffmvmpimiggfgnwlvplmigapdmafprmnnmsfwllppsfllllassmvea
gagtgwtvypplagnlahagasvdltifslhlagvssilgainfittiinmkppamsqyq
tplfvwsvmitavllllslpvlaagitmlltdrnlnttffdpagggdpilyqhlfwffgh
pevyililpgfgmishivtyysgkkepfgymgmvwammsigflgfivwahhmftvgmdvd
trayftsatmiiaiptgvkvfswlatlhggnikwspammwalgfiflftvggltgivlan
ssldivlhdtyyvvahfhyvlsmgavfaimggfvhwfplfsgytlndtwakihfaimfvg
vnmtffpqhflglsgmprrysdypdaytmwntissmgsfisltavmlmvfiiweafaskr
evltvdltttnlewlngcpppyhtfeeptyvnlk

SCOP Domain Coordinates for d2eija1:

Click to download the PDB-style file with coordinates for d2eija1.
(The format of our PDB-style files is described here.)

Timeline for d2eija1: