SCOPe 2.06: Domain d2eida3: 2eid A:151-537

Lineage for d2eida3 (2eid A:151-537)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
   consists of seven 4-stranded beta-sheet motifs; meander

4. Superfamily b.69.1: Galactose oxidase, central domain [50965] (2 families)

5. Family b.69.1.1: Galactose oxidase, central domain [50966] (2 proteins)

6. Protein automated matches [254521] (1 species)
   not a true protein

7. Species Fusarium graminearum (Gibberella zeae) [TaxId:5518] [255146] (2 PDB entries)

8. Domain d2eida3: 2eid A:151-537 [132135]
   Other proteins in same PDB: d2eida1, d2eida2
   automated match to d1gofa3
   complexed with cu, na; mutant

Details for d2eida3

PDB Entry: 2eid, 2.2 Å

PDB Description: galactose oxidase w290g mutant

PDB Compounds: (A:) Galactose oxidase

SCOPe Domain Sequences for d2eida3:

Sequence; same for both SEQRES and ATOM records:

>d2eida3 b.69.1.1 (A:151-537) automated matches {Fusarium graminearum (Gibberella zeae) [TaxId: 5518]}
ytapqpglgrwgptidlpivpaaaaieptsgrvlmwssyrndafggspggitltsswdps
tgivsdrtvtvtkhdmfcpgismdgngqivvtggndakktslydsssdswipgpdmqvar
gyqssatmsdgrvftiggsgsggvfekngevyspssktwtslpnakvnpmltadkqglyr
sdnhawlfgwkkgsvfqagpstamnwyytsgsgdvksagkrqsnrgvapdamcgnavmyd
avkgkiltfggspdyqdsdattnahiitlgepgtspntvfasnglyfartfhtsvvlpdg
stfitggqrrgipfedstpvftpeiyvpeqdtfykqnpnsivrvyhsislllpdgrvfng
ggglcgdcttnhfdaqiftpnylynsn

Timeline for d2eida3:

• d2eida3 first appeared in SCOP 1.73
  
• d2eida3 appears in SCOPe 2.05
  
• d2eida3 appears in SCOPe 2.07
  
• d2eida3 appears in the current release, SCOPe 2.08