Class b: All beta proteins [48724] (174 folds) |
Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies) consists of seven 4-stranded beta-sheet motifs; meander |
Superfamily b.69.1: Galactose oxidase, central domain [50965] (1 family) |
Family b.69.1.1: Galactose oxidase, central domain [50966] (1 protein) |
Protein Galactose oxidase, central domain [50967] (3 species) N-terminal domain is a jelly-roll sandwich C-terminal domain is Immunoglobulin-like |
Species Fusarium graminearum (Gibberella zeae) [TaxId:5518] [159255] (7 PDB entries) |
Domain d2eida3: 2eid A:151-537 [132135] Other proteins in same PDB: d2eida1, d2eida2 automatically matched to d1gof_3 complexed with cu, na; mutant |
PDB Entry: 2eid (more details), 2.2 Å
SCOPe Domain Sequences for d2eida3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2eida3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fusarium graminearum (Gibberella zeae) [TaxId: 5518]} ytapqpglgrwgptidlpivpaaaaieptsgrvlmwssyrndafggspggitltsswdps tgivsdrtvtvtkhdmfcpgismdgngqivvtggndakktslydsssdswipgpdmqvar gyqssatmsdgrvftiggsgsggvfekngevyspssktwtslpnakvnpmltadkqglyr sdnhawlfgwkkgsvfqagpstamnwyytsgsgdvksagkrqsnrgvapdamcgnavmyd avkgkiltfggspdyqdsdattnahiitlgepgtspntvfasnglyfartfhtsvvlpdg stfitggqrrgipfedstpvftpeiyvpeqdtfykqnpnsivrvyhsislllpdgrvfng ggglcgdcttnhfdaqiftpnylynsn
Timeline for d2eida3: