SCOPe 2.03: Domain d2eida3: 2eid A:151-537

Lineage for d2eida3 (2eid A:151-537)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies)
   consists of seven 4-stranded beta-sheet motifs; meander

4. Superfamily b.69.1: Galactose oxidase, central domain [50965] (1 family)

5. Family b.69.1.1: Galactose oxidase, central domain [50966] (1 protein)

6. Protein Galactose oxidase, central domain [50967] (3 species)
   N-terminal domain is a jelly-roll sandwich
   C-terminal domain is Immunoglobulin-like

7. Species Fusarium graminearum (Gibberella zeae) [TaxId:5518] [159255] (7 PDB entries)

8. Domain d2eida3: 2eid A:151-537 [132135]
   Other proteins in same PDB: d2eida1, d2eida2
   automatically matched to d1gof_3
   complexed with cu, na; mutant

Details for d2eida3

PDB Entry: 2eid, 2.2 Å

PDB Description: galactose oxidase w290g mutant

PDB Compounds: (A:) Galactose oxidase

SCOPe Domain Sequences for d2eida3:

Sequence; same for both SEQRES and ATOM records:

>d2eida3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fusarium graminearum (Gibberella zeae) [TaxId: 5518]}
ytapqpglgrwgptidlpivpaaaaieptsgrvlmwssyrndafggspggitltsswdps
tgivsdrtvtvtkhdmfcpgismdgngqivvtggndakktslydsssdswipgpdmqvar
gyqssatmsdgrvftiggsgsggvfekngevyspssktwtslpnakvnpmltadkqglyr
sdnhawlfgwkkgsvfqagpstamnwyytsgsgdvksagkrqsnrgvapdamcgnavmyd
avkgkiltfggspdyqdsdattnahiitlgepgtspntvfasnglyfartfhtsvvlpdg
stfitggqrrgipfedstpvftpeiyvpeqdtfykqnpnsivrvyhsislllpdgrvfng
ggglcgdcttnhfdaqiftpnylynsn

Timeline for d2eida3:

• d2eida3 first appeared in SCOP 1.73
  
• d2eida3 appears in SCOPe 2.02
  
• d2eida3 appears in SCOPe 2.04
  
• d2eida3 appears in the current release, SCOPe 2.08