SCOP 1.73: Domain d2eica1: 2eic A:538-639

Lineage for d2eica1 (2eic A:538-639)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (20 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (19 proteins)
   domains of unknown function associated with different type of catalytic domains in a different sequential location
   subgroup of the larger IPT/TIG domain family

6. Protein Galactose oxidase, C-terminal domain [49209] (2 species)
   follows the catalytic seven-bladed beta-propeller domain

7. Species Dactylium dendroides [TaxId:5132] [49210] (8 PDB entries)

8. Domain d2eica1: 2eic A:538-639 [132130]
   Other proteins in same PDB: d2eica2, d2eica3
   automatically matched to d1gof_1
   complexed with cu1, na; mutant

Details for d2eica1

PDB Entry: 2eic, 2.8 Å

PDB Description: crystal structure of galactose oxidase mutant w290f

PDB Compounds: (A:) Galactose oxidase

SCOP Domain Sequences for d2eica1:

Sequence; same for both SEQRES and ATOM records:

>d2eica1 b.1.18.2 (A:538-639) Galactose oxidase, C-terminal domain {Dactylium dendroides [TaxId: 5132]}
gnlatrpkitrtstqsvkvggritistdssiskaslirygtathtvntdqrripltltnn
ggnsysfqvpsdsgvalpgywmlfvmnsagvpsvastirvtq

Timeline for d2eica1:

• d2eica1 is new in SCOP 1.73
  
• d2eica1 appears in SCOP 1.75
  
• d2eica1 appears in the current release, SCOPe 2.08