Lineage for d2efxb_ (2efx B:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2568471Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2568472Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2568473Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 2569138Protein D-Amino acid amidase DaaA [144038] (1 species)
  7. 2569139Species Ochrobactrum anthropi [TaxId:529] [144039] (6 PDB entries)
    Uniprot Q9LCC8 2-363
  8. 2569153Domain d2efxb_: 2efx B: [132116]
    automated match to d2dnsa1
    complexed with ba, nfa

Details for d2efxb_

PDB Entry: 2efx (more details), 2.2 Å

PDB Description: The crystal structure of D-amino acid amidase from Ochrobactrum anthropi SV3 complexed with L-phenylalanine amide
PDB Compounds: (B:) D-amino acid amidase

SCOPe Domain Sequences for d2efxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2efxb_ e.3.1.1 (B:) D-Amino acid amidase DaaA {Ochrobactrum anthropi [TaxId: 529]}
sdlnnaiqgilddhvargvvgvslalclpgeetslyqsgyadkfnkmpmtgdhlfriasc
tksfiatglhllvqdgtvdldepitrwfpdlpkaaqmpvrillnhrsglpdfetsmpmis
dkswtaqeivdfsfrhgvqkepwhgmeysntgyvlagmiiahetgkpysdhlrsrifapl
gmkdtwvgthetfpiereargymhaaaddenpqwdvsgagdpvdgvwdstewfplsgana
agdmvstprdivkflnalfdgrildqkrlwemkdnikpaffpgsntvanghglllmrygs
selkghlgqipghtsimgrdeetgaalmliqnsgagdfesfylkgvnepvdrvleaikns
rs

SCOPe Domain Coordinates for d2efxb_:

Click to download the PDB-style file with coordinates for d2efxb_.
(The format of our PDB-style files is described here.)

Timeline for d2efxb_: