SCOPe 2.05: Domain d2efxa_: 2efx A:

Lineage for d2efxa_ (2efx A:)

1. Root: SCOPe 2.05

2. Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)

6. Protein D-Amino acid amidase DaaA [144038] (1 species)

7. Species Ochrobactrum anthropi [TaxId:529] [144039] (4 PDB entries)
   Uniprot Q9LCC8 2-363

8. Domain d2efxa_: 2efx A: [132115]
   automated match to d2dnsa1
   complexed with ba, nfa

Details for d2efxa_

PDB Entry: 2efx, 2.2 Å

PDB Description: The crystal structure of D-amino acid amidase from Ochrobactrum anthropi SV3 complexed with L-phenylalanine amide

PDB Compounds: (A:) D-amino acid amidase

SCOPe Domain Sequences for d2efxa_:

Sequence; same for both SEQRES and ATOM records:

>d2efxa_ e.3.1.1 (A:) D-Amino acid amidase DaaA {Ochrobactrum anthropi [TaxId: 529]}
sdlnnaiqgilddhvargvvgvslalclpgeetslyqsgyadkfnkmpmtgdhlfriasc
tksfiatglhllvqdgtvdldepitrwfpdlpkaaqmpvrillnhrsglpdfetsmpmis
dkswtaqeivdfsfrhgvqkepwhgmeysntgyvlagmiiahetgkpysdhlrsrifapl
gmkdtwvgthetfpiereargymhaaaddenpqwdvsgagdpvdgvwdstewfplsgana
agdmvstprdivkflnalfdgrildqkrlwemkdnikpaffpgsntvanghglllmrygs
selkghlgqipghtsimgrdeetgaalmliqnsgagdfesfylkgvnepvdrvleaikns
rs

Timeline for d2efxa_:

• d2efxa_ first appeared in SCOP 1.73, called d2efxa1
  
• d2efxa_ appears in SCOPe 2.04
  
• d2efxa_ appears in SCOPe 2.06
  
• d2efxa_ appears in the current release, SCOPe 2.08