Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds) |
Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) |
Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins) |
Protein D-Amino acid amidase DaaA [144038] (1 species) |
Species Ochrobactrum anthropi [TaxId:529] [144039] (4 PDB entries) Uniprot Q9LCC8 2-363 |
Domain d2efxa_: 2efx A: [132115] automated match to d2dnsa1 complexed with ba, nfa |
PDB Entry: 2efx (more details), 2.2 Å
SCOPe Domain Sequences for d2efxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2efxa_ e.3.1.1 (A:) D-Amino acid amidase DaaA {Ochrobactrum anthropi [TaxId: 529]} sdlnnaiqgilddhvargvvgvslalclpgeetslyqsgyadkfnkmpmtgdhlfriasc tksfiatglhllvqdgtvdldepitrwfpdlpkaaqmpvrillnhrsglpdfetsmpmis dkswtaqeivdfsfrhgvqkepwhgmeysntgyvlagmiiahetgkpysdhlrsrifapl gmkdtwvgthetfpiereargymhaaaddenpqwdvsgagdpvdgvwdstewfplsgana agdmvstprdivkflnalfdgrildqkrlwemkdnikpaffpgsntvanghglllmrygs selkghlgqipghtsimgrdeetgaalmliqnsgagdfesfylkgvnepvdrvleaikns rs
Timeline for d2efxa_: