Lineage for d2efuf1 (2efu F:4-358)

  1. Root: SCOP 1.75
  2. 883176Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 883341Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 883342Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (3 families) (S)
  5. 883343Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (18 proteins)
  6. 883669Protein D-Amino acid amidase DaaA [144038] (1 species)
  7. 883670Species Ochrobactrum anthropi [TaxId:529] [144039] (4 PDB entries)
    Uniprot Q9LCC8 2-363
  8. 883682Domain d2efuf1: 2efu F:4-358 [132114]
    automatically matched to 2DRW A:2-363
    complexed with ba, phe

Details for d2efuf1

PDB Entry: 2efu (more details), 2.3 Å

PDB Description: The crystal structure of D-amino acid amidase from Ochrobactrum anthropi SV3 complexed with L-phenylalanine
PDB Compounds: (F:) D-amino acid amidase

SCOP Domain Sequences for d2efuf1:

Sequence, based on SEQRES records: (download)

>d2efuf1 e.3.1.1 (F:4-358) D-Amino acid amidase DaaA {Ochrobactrum anthropi [TaxId: 529]}
lnnaiqgilddhvargvvgvslalclpgeetslyqsgyadkfnkmpmtgdhlfriasctk
sfiatglhllvqdgtvdldepitrwfpdlpkaaqmpvrillnhrsglpdfetsmpmisdk
swtaqeivdfsfrhgvqkepwhgmeysntgyvlagmiiahetgkpysdhlrsrifaplgm
kdtwvgthetfpiereargymhaaaddenpqwdvsgagdpvdgvwdstewfplsganaag
dmvstprdivkflnalfdgrildqkrlwemkdnikpaffpgsntvanghglllmrygsse
lkghlgqipghtsimgrdeetgaalmliqnsgagdfesfylkgvnepvdrvleai

Sequence, based on observed residues (ATOM records): (download)

>d2efuf1 e.3.1.1 (F:4-358) D-Amino acid amidase DaaA {Ochrobactrum anthropi [TaxId: 529]}
lnnaiqgilddhvargvvgvslalclpgeetslyqsgyadkmpmtgdhlfriasctksfi
atglhllvqdgtvdldepitrwfpdlpkaaqmpvrillnhrsglpdfetsmpmisdkswt
aqeivdfsfrhgvqkepwhgmeysntgyvlagmiiahetgkpysdhlrsrifaplgmkdt
wvgthetfpiereargymhwdstewfplsganaagdmvstprdivkflnalfdgrildqk
rlwemkdnikpaffpgsntvanghglllmrygsselkghlgqipghtsimgrdeetgaal
mliqnsgagdfesfylkgvnepvdrvleai

SCOP Domain Coordinates for d2efuf1:

Click to download the PDB-style file with coordinates for d2efuf1.
(The format of our PDB-style files is described here.)

Timeline for d2efuf1: