Lineage for d2efub_ (2efu B:)

  1. Root: SCOPe 2.05
  2. 1949014Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1949285Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1949286Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1949287Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1949875Protein D-Amino acid amidase DaaA [144038] (1 species)
  7. 1949876Species Ochrobactrum anthropi [TaxId:529] [144039] (4 PDB entries)
    Uniprot Q9LCC8 2-363
  8. 1949890Domain d2efub_: 2efu B: [132110]
    automated match to d2dnsa1
    complexed with ba, phe

Details for d2efub_

PDB Entry: 2efu (more details), 2.3 Å

PDB Description: The crystal structure of D-amino acid amidase from Ochrobactrum anthropi SV3 complexed with L-phenylalanine
PDB Compounds: (B:) D-amino acid amidase

SCOPe Domain Sequences for d2efub_:

Sequence, based on SEQRES records: (download)

>d2efub_ e.3.1.1 (B:) D-Amino acid amidase DaaA {Ochrobactrum anthropi [TaxId: 529]}
lnnaiqgilddhvargvvgvslalclpgeetslyqsgyadkfnkmpmtgdhlfriasctk
sfiatglhllvqdgtvdldepitrwfpdlpkaaqmpvrillnhrsglpdfetsmpmisdk
swtaqeivdfsfrhgvqkepwhgmeysntgyvlagmiiahetgkpysdhlrsrifaplgm
kdtwvgthetfpiereargymhaaaddenpqwdvsgagdpvdgvwdstewfplsganaag
dmvstprdivkflnalfdgrildqkrlwemkdnikpaffpgsntvanghglllmrygsse
lkghlgqipghtsimgrdeetgaalmliqnsgagdfesfylkgvnepvdrvleaiknsrs

Sequence, based on observed residues (ATOM records): (download)

>d2efub_ e.3.1.1 (B:) D-Amino acid amidase DaaA {Ochrobactrum anthropi [TaxId: 529]}
lnnaiqgilddhvargvvgvslalclpgeetslyqsgyadkfnkmpmtgdhlfriasctk
sfiatglhllvqdgtvdldepitrwfpdlpkaaqmpvrillnhrsglpdfetsmpmisdk
swtaqeivdfsfrhgvqkepwhgmeysntgyvlagmiiahetgkpysdhlrsrifaplgm
kdtwvgthetfpiereargymhaaddenpqwdvsgagdpvdgvwdstewfplsganaagd
mvstprdivkflnalfdgrildqkrlwemkdnikpaffpgsntvanghglllmrygssel
kghlgqipghtsimgrdeetgaalmliqnsgagdfesfylkgvnepvdrvleaiknsrs

SCOPe Domain Coordinates for d2efub_:

Click to download the PDB-style file with coordinates for d2efub_.
(The format of our PDB-style files is described here.)

Timeline for d2efub_: