Lineage for d2e81a1 (2e81 A:37-507)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 778525Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
    variable number of helices and little beta structure; not a true fold
  4. 778526Superfamily a.138.1: Multiheme cytochromes [48695] (3 families) (S)
    duplication: contains multiple CxxCH motifs
  5. 778614Family a.138.1.3: Di-heme elbow motif [48711] (7 proteins)
    the main characteristic feature of this motif is the packing of its two hemes
    many members contains one or more complete motifs flanked by incomplete motifs and/or other domains
  6. 778615Protein Cytochrome c nitrite reductase [48718] (4 species)
  7. 778632Species Wolinella succinogenes [TaxId:844] [48720] (6 PDB entries)
  8. 778638Domain d2e81a1: 2e81 A:37-507 [132093]
    automatically matched to d1fs7a_
    complexed with ca, hem, hoa, yt3

Details for d2e81a1

PDB Entry: 2e81 (more details), 2 Å

PDB Description: cytochrome c nitrite reductase from wolinella succinogenes with bound intermediate hydroxylamine
PDB Compounds: (A:) Cytochrome c-552

SCOP Domain Sequences for d2e81a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e81a1 a.138.1.3 (A:37-507) Cytochrome c nitrite reductase {Wolinella succinogenes [TaxId: 844]}
ktahsqgiegkamseewaryyprqfdswkktkesdnitdmlkekpalvvawagypfskdy
naprghyyalqdnintlrtgapvdgktgplpsacwtckspdvpriieqdgeleyftgkwa
kygdeivntigcynchddksaelkskvpyldrglsaagfktfaesthqekrslvcaqchv
eyyfkktewkddkgvdktamvvtlpwskgisteqmeayydeinfadwthgisktpmlkaq
hpdwelyktgihgqkgvscadchmpytqegavkysdhkvgnpldnmdkscmnchreseqk
lkdivkqkferkeflqdiafdnigkahletgkamelgatdaelkeirthirhaqwradma
iaghgsffhapeevlrllasgneeaqkariklvkvlakygaidyvapdfetkekaqklak
vdmeafiaeklkfkqtleqewkkqaiakgrlnpeslkgvdekssyydktkk

SCOP Domain Coordinates for d2e81a1:

Click to download the PDB-style file with coordinates for d2e81a1.
(The format of our PDB-style files is described here.)

Timeline for d2e81a1: