SCOPe 2.05: Domain d2e7sf_: 2e7s F:

Lineage for d2e7sf_ (2e7s F:)

1. Root: SCOPe 2.05

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (35 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.33: Sec2 N-terminal region [144284] (1 family)
   dimeric coiled coil

5. Family h.1.33.1: Sec2 N-terminal region [144285] (2 proteins)

6. Protein automated matches [254514] (1 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255133] (1 PDB entry)

8. Domain d2e7sf_: 2e7s F: [132073]
   Other proteins in same PDB: d2e7sa1
   automated match to d2e7sg1

Details for d2e7sf_

PDB Entry: 2e7s, 3 Å

PDB Description: crystal structure of the yeast sec2p gef domain

PDB Compounds: (F:) Rab guanine nucleotide exchange factor SEC2

SCOPe Domain Sequences for d2e7sf_:

Sequence; same for both SEQRES and ATOM records:

>d2e7sf_ h.1.33.1 (F:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
leeqlnkslktiasqkaaienynqlkedyntlkrelsdrddevkrlrediakenelrtka
eeeadklnkevedltaslfdeannlvadarmekyaieilnkrlteqlrekdmlldtltlq
lknl

Timeline for d2e7sf_:

• d2e7sf_ first appeared in SCOP 1.73, called d2e7sf1
  
• d2e7sf_ appears in SCOPe 2.04
  
• d2e7sf_ appears in SCOPe 2.06
  
• d2e7sf_ appears in the current release, SCOPe 2.08