Lineage for d2e76d2 (2e76 D:12-45)

  1. Root: SCOPe 2.04
  2. 1695624Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1697651Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 1698284Superfamily f.23.12: ISP transmembrane anchor [81502] (2 families) (S)
  5. 1698285Family f.23.12.1: ISP transmembrane anchor [81501] (2 proteins)
  6. 1698324Protein ISP subunit from the cytochrome b6f complex, transmembrane anchor [103428] (2 species)
  7. Species Mastigocladus laminosus [TaxId:83541] [103429] (4 PDB entries)
  8. 1698328Domain d2e76d2: 2e76 D:12-45 [132060]
    Other proteins in same PDB: d2e76a1, d2e76b1, d2e76d1, d2e76e1, d2e76f1, d2e76g1, d2e76h1
    automatically matched to d1vf5d2
    complexed with bcr, cd, cla, fes, hem, opc, sqd, tds, umq

Details for d2e76d2

PDB Entry: 2e76 (more details), 3.41 Å

PDB Description: Crystal Structure of the Cytochrome b6f Complex with tridecyl-stigmatellin (TDS) from M.laminosus
PDB Compounds: (D:) Cytochrome b6-f complex iron-sulfur subunit

SCOPe Domain Sequences for d2e76d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e76d2 f.23.12.1 (D:12-45) ISP subunit from the cytochrome b6f complex, transmembrane anchor {Mastigocladus laminosus [TaxId: 83541]}
dmgrrqfmnllafgtvtgvalgalyplvkyfipp

SCOPe Domain Coordinates for d2e76d2:

Click to download the PDB-style file with coordinates for d2e76d2.
(The format of our PDB-style files is described here.)

Timeline for d2e76d2: