Class f: Membrane and cell surface proteins and peptides [56835] (50 folds) |
Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies) core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices |
Superfamily f.21.1: Transmembrane di-heme cytochromes [81342] (2 families) Three of the four heme-ligands are conserved between the two families; both heme groups bind similarly but not identically |
Family f.21.1.2: Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81642] (2 proteins) a part (domain) of a larger mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria |
Protein Cytochrome b6 subunit of the cytochrome b6f complex [103498] (2 species) |
Species Mastigocladus laminosus [TaxId:83541] [103499] (5 PDB entries) |
Domain d2e76a1: 2e76 A:13-214 [132058] Other proteins in same PDB: d2e76d1, d2e76d2, d2e76f1, d2e76g1 automatically matched to d1vf5a_ complexed with bcr, cd, cla, fes, hem, opc, sqd, tds, umq |
PDB Entry: 2e76 (more details), 3.41 Å
SCOP Domain Sequences for d2e76a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2e76a1 f.21.1.2 (A:13-214) Cytochrome b6 subunit of the cytochrome b6f complex {Mastigocladus laminosus [TaxId: 83541]} eiqaladdvtskyvpphvnifyclggitltcfliqfatgfamtfyykptvteayasvqyi mnevsfgwlirsihrwsasmmvlmmilhvfrvyltggfkkpreltwisgvilavitvsfg vtgyslpwdqvgywavkivsgvpeaipvvgvlisdllrggssvgqatltryysahtfvlp wliavfmllhflmirkqgisgp
Timeline for d2e76a1:
View in 3D Domains from other chains: (mouse over for more information) d2e76d1, d2e76d2, d2e76f1, d2e76g1 |