SCOPe 2.02: Domain d2e75d2: 2e75 D:12-45

Lineage for d2e75d2 (2e75 D:12-45)

1. Root: SCOPe 2.02

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
   not a true fold

4. Superfamily f.23.12: ISP transmembrane anchor [81502] (1 family)

5. Family f.23.12.1: ISP transmembrane anchor [81501] (2 proteins)

6. Protein ISP subunit from the cytochrome b6f complex, transmembrane anchor [103428] (2 species)

7. Species Mastigocladus laminosus [TaxId:83541] [103429] (5 PDB entries)

8. Domain d2e75d2: 2e75 D:12-45 [132055]
   Other proteins in same PDB: d2e75a1, d2e75b1, d2e75d1, d2e75e1, d2e75f1, d2e75g1, d2e75h1
   automatically matched to d1vf5d2
   complexed with bcr, cd, cla, fes, hem, opc, qno, sqd, umq

Details for d2e75d2

PDB Entry: 2e75, 3.55 Å

PDB Description: Crystal Structure of the Cytochrome b6f Complex with 2-nonyl-4-hydroxyquinoline N-oxide (NQNO) from M.laminosus

PDB Compounds: (D:) Cytochrome b6-f complex iron-sulfur subunit

SCOPe Domain Sequences for d2e75d2:

Sequence; same for both SEQRES and ATOM records:

>d2e75d2 f.23.12.1 (D:12-45) ISP subunit from the cytochrome b6f complex, transmembrane anchor {Mastigocladus laminosus [TaxId: 83541]}
dmgrrqfmnllafgtvtgvalgalyplvkyfipp

Timeline for d2e75d2:

• d2e75d2 first appeared in SCOP 1.73
  
• d2e75d2 appears in SCOPe 2.01
  
• d2e75d2 appears in SCOPe 2.03
  
• d2e75d2 appears in the current release, SCOPe 2.08