Lineage for d2e75d1 (2e75 D:46-179)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1535669Fold b.33: ISP domain [50021] (1 superfamily)
    consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)
  4. 1535670Superfamily b.33.1: ISP domain [50022] (4 families) (S)
  5. 1535671Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (9 proteins)
  6. 1535683Protein ISP subunit from the cytochrome b6f complex, soluble domain [101665] (2 species)
  7. Species Mastigocladus laminosus [TaxId:83541] [101666] (4 PDB entries)
  8. 1535690Domain d2e75d1: 2e75 D:46-179 [132054]
    Other proteins in same PDB: d2e75a1, d2e75b1, d2e75d2, d2e75e1, d2e75f1, d2e75g1, d2e75h1
    automatically matched to d1vf5d1
    complexed with bcr, cd, cla, fes, hem, opc, qno, sqd, umq

Details for d2e75d1

PDB Entry: 2e75 (more details), 3.55 Å

PDB Description: Crystal Structure of the Cytochrome b6f Complex with 2-nonyl-4-hydroxyquinoline N-oxide (NQNO) from M.laminosus
PDB Compounds: (D:) Cytochrome b6-f complex iron-sulfur subunit

SCOPe Domain Sequences for d2e75d1:

Sequence, based on SEQRES records: (download)

>d2e75d1 b.33.1.1 (D:46-179) ISP subunit from the cytochrome b6f complex, soluble domain {Mastigocladus laminosus [TaxId: 83541]}
sggavgggttakdklgnnvkvskfleshnagdrvlvqglkgdptyivveskeairdygin
avcthlgcvvpwnaaenkfkcpchgsqydetgkvirgpaplslalchatvqddnivltpw
tetdfrtgekpwwv

Sequence, based on observed residues (ATOM records): (download)

>d2e75d1 b.33.1.1 (D:46-179) ISP subunit from the cytochrome b6f complex, soluble domain {Mastigocladus laminosus [TaxId: 83541]}
sggavgggttakdklgnnvkvskfleshnagdrvlvqglkgdptyivairdyginavcth
lgcvvpwnaaenkfkcpchgsqydetgkvirgpaplslalchatvqddnivltpwtetdf
rtgekpwwv

SCOPe Domain Coordinates for d2e75d1:

Click to download the PDB-style file with coordinates for d2e75d1.
(The format of our PDB-style files is described here.)

Timeline for d2e75d1: