SCOP 1.73: Domain d2e75d1: 2e75 D:46-179

Lineage for d2e75d1 (2e75 D:46-179)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.33: ISP domain [50021] (1 superfamily)
   consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)

4. Superfamily b.33.1: ISP domain [50022] (2 families)

5. Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (8 proteins)

6. Protein ISP subunit from the cytochrome b6f complex, soluble domain [101665] (2 species)

7. Species Mastigocladus laminosus [TaxId:83541] [101666] (5 PDB entries)

8. Domain d2e75d1: 2e75 D:46-179 [132054]
   Other proteins in same PDB: d2e75a1, d2e75d2, d2e75f1, d2e75g1
   automatically matched to d1vf5d1
   complexed with bcr, cd, cla, fes, hem, opc, qno, sqd, umq

Details for d2e75d1

PDB Entry: 2e75, 3.55 Å

PDB Description: Crystal Structure of the Cytochrome b6f Complex with 2-nonyl-4-hydroxyquinoline N-oxide (NQNO) from M.laminosus

PDB Compounds: (D:) Cytochrome b6-f complex iron-sulfur subunit

SCOP Domain Sequences for d2e75d1:

Sequence, based on SEQRES records:

>d2e75d1 b.33.1.1 (D:46-179) ISP subunit from the cytochrome b6f complex, soluble domain {Mastigocladus laminosus [TaxId: 83541]}
sggavgggttakdklgnnvkvskfleshnagdrvlvqglkgdptyivveskeairdygin
avcthlgcvvpwnaaenkfkcpchgsqydetgkvirgpaplslalchatvqddnivltpw
tetdfrtgekpwwv

Sequence, based on observed residues (ATOM records):

>d2e75d1 b.33.1.1 (D:46-179) ISP subunit from the cytochrome b6f complex, soluble domain {Mastigocladus laminosus [TaxId: 83541]}
sggavgggttakdklgnnvkvskfleshnagdrvlvqglkgdptyivairdyginavcth
lgcvvpwnaaenkfkcpchgsqydetgkvirgpaplslalchatvqddnivltpwtetdf
rtgekpwwv

Timeline for d2e75d1:

• d2e75d1 is new in SCOP 1.73
  
• d2e75d1 appears in SCOP 1.75
  
• d2e75d1 appears in the current release, SCOPe 2.08