| Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
| Fold f.23: Single transmembrane helix [81407] (40 superfamilies) not a true fold |
Superfamily f.23.26: PetG subunit of the cytochrome b6f complex [103446] (1 family) ![]() |
| Family f.23.26.1: PetG subunit of the cytochrome b6f complex [103447] (2 proteins) |
| Protein automated matches [196847] (1 species) not a true protein |
| Species Mastigocladus laminosus [TaxId:83541] [196848] (4 PDB entries) |
| Domain d2e74g_: 2e74 G: [132052] Other proteins in same PDB: d2e74a_, d2e74b1, d2e74d1, d2e74d2, d2e74e1, d2e74f_, d2e74h_ automated match to d4i7zg_ complexed with bcr, cd, cla, fes, hem, opc, sqd, umq |
PDB Entry: 2e74 (more details), 3 Å
SCOPe Domain Sequences for d2e74g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2e74g_ f.23.26.1 (G:) automated matches {Mastigocladus laminosus [TaxId: 83541]}
mveplldglvlglvfatlgglfyaayqqykrpnelgg
Timeline for d2e74g_: