SCOPe 2.05: Domain d2e74f_: 2e74 F:

Lineage for d2e74f_ (2e74 F:)

1. Root: SCOPe 2.05

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.23: Single transmembrane helix [81407] (40 superfamilies)
   not a true fold

4. Superfamily f.23.25: PetM subunit of the cytochrome b6f complex [103441] (1 family)

5. Family f.23.25.1: PetM subunit of the cytochrome b6f complex [103442] (2 proteins)

6. Protein PetM subunit of the cytochrome b6f complex [103443] (2 species)

7. Species Mastigocladus laminosus [TaxId:83541] [103444] (8 PDB entries)

8. Domain d2e74f_: 2e74 F: [132051]
   Other proteins in same PDB: d2e74a_, d2e74b1, d2e74d1, d2e74d2, d2e74e1, d2e74g_, d2e74h_
   automated match to d1vf5s_
   complexed with bcr, cd, cla, fes, hem, opc, sqd, umq

Details for d2e74f_

PDB Entry: 2e74, 3 Å

PDB Description: Crystal Structure of the Cytochrome b6f Complex from M.laminosus

PDB Compounds: (F:) Cytochrome b6-f complex subunit 7

SCOPe Domain Sequences for d2e74f_:

Sequence; same for both SEQRES and ATOM records:

>d2e74f_ f.23.25.1 (F:) PetM subunit of the cytochrome b6f complex {Mastigocladus laminosus [TaxId: 83541]}
mteemlyaallsfglifvgwglgvlllkiqga

Timeline for d2e74f_:

• d2e74f_ first appeared in SCOP 1.73, called d2e74f1
  
• d2e74f_ appears in SCOPe 2.04
  
• d2e74f_ appears in SCOPe 2.06
  
• d2e74f_ appears in the current release, SCOPe 2.08