| Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
| Fold f.23: Single transmembrane helix [81407] (40 superfamilies) not a true fold |
Superfamily f.23.25: PetM subunit of the cytochrome b6f complex [103441] (1 family) ![]() |
| Family f.23.25.1: PetM subunit of the cytochrome b6f complex [103442] (2 proteins) |
| Protein PetM subunit of the cytochrome b6f complex [103443] (2 species) |
| Species Mastigocladus laminosus [TaxId:83541] [103444] (8 PDB entries) |
| Domain d2e74f_: 2e74 F: [132051] Other proteins in same PDB: d2e74a_, d2e74b1, d2e74d1, d2e74d2, d2e74e1, d2e74g_, d2e74h_ automated match to d1vf5s_ complexed with bcr, cd, cla, fes, hem, opc, sqd, umq |
PDB Entry: 2e74 (more details), 3 Å
SCOPe Domain Sequences for d2e74f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2e74f_ f.23.25.1 (F:) PetM subunit of the cytochrome b6f complex {Mastigocladus laminosus [TaxId: 83541]}
mteemlyaallsfglifvgwglgvlllkiqga
Timeline for d2e74f_: