Lineage for d2e74d1 (2e74 D:46-179)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 664899Fold b.33: ISP domain [50021] (1 superfamily)
    consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)
  4. 664900Superfamily b.33.1: ISP domain [50022] (2 families) (S)
  5. 664901Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (8 proteins)
  6. 664913Protein ISP subunit from the cytochrome b6f complex, soluble domain [101665] (2 species)
  7. 664916Species Mastigocladus laminosus [TaxId:83541] [101666] (5 PDB entries)
  8. 664917Domain d2e74d1: 2e74 D:46-179 [132049]
    Other proteins in same PDB: d2e74a1, d2e74d2, d2e74f1, d2e74g1
    automatically matched to d1vf5d1
    complexed with bcr, cd, cla, fes, hem, opc, sqd, umq

Details for d2e74d1

PDB Entry: 2e74 (more details), 3 Å

PDB Description: Crystal Structure of the Cytochrome b6f Complex from M.laminosus
PDB Compounds: (D:) Cytochrome b6-f complex iron-sulfur subunit

SCOP Domain Sequences for d2e74d1:

Sequence, based on SEQRES records: (download)

>d2e74d1 b.33.1.1 (D:46-179) ISP subunit from the cytochrome b6f complex, soluble domain {Mastigocladus laminosus [TaxId: 83541]}
sggavgggttakdklgnnvkvskfleshnagdrvlvqglkgdptyivveskeairdygin
avcthlgcvvpwnaaenkfkcpchgsqydetgkvirgpaplslalchatvqddnivltpw
tetdfrtgekpwwv

Sequence, based on observed residues (ATOM records): (download)

>d2e74d1 b.33.1.1 (D:46-179) ISP subunit from the cytochrome b6f complex, soluble domain {Mastigocladus laminosus [TaxId: 83541]}
sggavgggttakdklgnnvkvskfleshnagdrvlvqglkgdptyivairdyginavcth
lgcvvpwnaaenkfkcpchgsqydetgkvirgpaplslalchatvqddnivltpwtetdf
rtgekpwwv

SCOP Domain Coordinates for d2e74d1:

Click to download the PDB-style file with coordinates for d2e74d1.
(The format of our PDB-style files is described here.)

Timeline for d2e74d1: