Lineage for d2e5lt1 (2e5l T:8-106)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 636659Fold a.7: Spectrin repeat-like [46965] (15 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 636765Superfamily a.7.6: Ribosomal protein S20 [46992] (1 family) (S)
  5. 636766Family a.7.6.1: Ribosomal protein S20 [46993] (1 protein)
    this is a repeat family; one repeat unit is 2gyb T:4-86 found in domain
  6. 636767Protein Ribosomal protein S20 [46994] (1 species)
  7. 636768Species Thermus thermophilus [TaxId:274] [46995] (36 PDB entries)
  8. 636791Domain d2e5lt1: 2e5l T:8-106 [132044]
    Other proteins in same PDB: d2e5lc1, d2e5lc2, d2e5ld1, d2e5le1, d2e5le2, d2e5lf1, d2e5lg1, d2e5lh1, d2e5li1, d2e5lj1, d2e5lk1, d2e5ll1, d2e5lm1, d2e5ln1, d2e5lo1, d2e5lp1, d2e5lq1, d2e5lr1, d2e5ls1
    automatically matched to d1fjgt_
    complexed with zn

Details for d2e5lt1

PDB Entry: 2e5l (more details), 3.3 Å

PDB Description: a snapshot of the 30s ribosomal subunit capturing mrna via the shine- dalgarno interaction
PDB Compounds: (T:) 30S ribosomal protein S20

SCOP Domain Sequences for d2e5lt1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e5lt1 a.7.6.1 (T:8-106) Ribosomal protein S20 {Thermus thermophilus [TaxId: 274]}
rnlsalkrhrqslkrrlrnkakksaiktlskkavqlaqegkaeealkimrkaeslidkaa
kgstlhknaaarrksrlmrkvrqlleaagapliggglsa

SCOP Domain Coordinates for d2e5lt1:

Click to download the PDB-style file with coordinates for d2e5lt1.
(The format of our PDB-style files is described here.)

Timeline for d2e5lt1: