| Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
| Fold d.28: Ribosomal protein S19 [54569] (1 superfamily) alpha-beta-X-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 123 |
Superfamily d.28.1: Ribosomal protein S19 [54570] (1 family) ![]() automatically mapped to Pfam PF00203 |
| Family d.28.1.1: Ribosomal protein S19 [54571] (1 protein) |
| Protein Ribosomal protein S19 [54572] (2 species) |
| Species Thermus thermophilus [TaxId:274] [54573] (38 PDB entries) Uniprot P80381 |
| Domain d2e5ls1: 2e5l S:2-81 [132043] Other proteins in same PDB: d2e5lc1, d2e5lc2, d2e5ld1, d2e5le1, d2e5le2, d2e5lf1, d2e5lg1, d2e5lh1, d2e5li1, d2e5lj1, d2e5lk1, d2e5ll1, d2e5lm1, d2e5ln1, d2e5lo1, d2e5lp1, d2e5lq1, d2e5lr1, d2e5lt1, d2e5lv1 automatically matched to d1fjgs_ complexed with zn |
PDB Entry: 2e5l (more details), 3.3 Å
SCOPe Domain Sequences for d2e5ls1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2e5ls1 d.28.1.1 (S:2-81) Ribosomal protein S19 {Thermus thermophilus [TaxId: 274]}
prslkkgvfvddhllekvlelnakgekrliktwsrrstivpemvghtiavyngkqhvpvy
itenmvghklgefaptrtyr
Timeline for d2e5ls1: