SCOPe 2.03: Domain d2e5ls1: 2e5l S:2-81

Lineage for d2e5ls1 (2e5l S:2-81)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.28: Ribosomal protein S19 [54569] (1 superfamily)
   alpha-beta-X-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 123

4. Superfamily d.28.1: Ribosomal protein S19 [54570] (1 family)
   automatically mapped to Pfam PF00203

5. Family d.28.1.1: Ribosomal protein S19 [54571] (1 protein)

6. Protein Ribosomal protein S19 [54572] (2 species)

7. Species Thermus thermophilus [TaxId:274] [54573] (38 PDB entries)
   Uniprot P80381

8. Domain d2e5ls1: 2e5l S:2-81 [132043]
   Other proteins in same PDB: d2e5lc1, d2e5lc2, d2e5ld1, d2e5le1, d2e5le2, d2e5lf1, d2e5lg1, d2e5lh1, d2e5li1, d2e5lj1, d2e5lk1, d2e5ll1, d2e5lm1, d2e5ln1, d2e5lo1, d2e5lp1, d2e5lq1, d2e5lr1, d2e5lt1, d2e5lv1
   automatically matched to d1fjgs_
   complexed with zn

Details for d2e5ls1

PDB Entry: 2e5l, 3.3 Å

PDB Description: a snapshot of the 30s ribosomal subunit capturing mrna via the shine- dalgarno interaction

PDB Compounds: (S:) 30S ribosomal protein S19

SCOPe Domain Sequences for d2e5ls1:

Sequence; same for both SEQRES and ATOM records:

>d2e5ls1 d.28.1.1 (S:2-81) Ribosomal protein S19 {Thermus thermophilus [TaxId: 274]}
prslkkgvfvddhllekvlelnakgekrliktwsrrstivpemvghtiavyngkqhvpvy
itenmvghklgefaptrtyr

Timeline for d2e5ls1:

• d2e5ls1 first appeared in SCOP 1.73
  
• d2e5ls1 appears in SCOPe 2.02
  
• d2e5ls1 appears in SCOPe 2.04
  
• d2e5ls1 appears in the current release, SCOPe 2.08