SCOPe 2.03: Domain d2e5lr1: 2e5l R:16-88

Lineage for d2e5lr1 (2e5l R:16-88)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.8: Ribosomal protein S18 [46911] (1 family)

5. Family a.4.8.1: Ribosomal protein S18 [46912] (1 protein)

6. Protein Ribosomal protein S18 [46913] (2 species)

7. Species Thermus thermophilus [TaxId:274] [46914] (47 PDB entries)
   Uniprot P80382

8. Domain d2e5lr1: 2e5l R:16-88 [132042]
   Other proteins in same PDB: d2e5lc1, d2e5lc2, d2e5ld1, d2e5le1, d2e5le2, d2e5lf1, d2e5lg1, d2e5lh1, d2e5li1, d2e5lj1, d2e5lk1, d2e5ll1, d2e5lm1, d2e5ln1, d2e5lo1, d2e5lp1, d2e5lq1, d2e5ls1, d2e5lt1, d2e5lv1
   automatically matched to d1i94r_
   complexed with zn

Details for d2e5lr1

PDB Entry: 2e5l, 3.3 Å

PDB Description: a snapshot of the 30s ribosomal subunit capturing mrna via the shine- dalgarno interaction

PDB Compounds: (R:) 30S ribosomal protein S18

SCOPe Domain Sequences for d2e5lr1:

Sequence; same for both SEQRES and ATOM records:

>d2e5lr1 a.4.8.1 (R:16-88) Ribosomal protein S18 {Thermus thermophilus [TaxId: 274]}
psrkakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsgkeqrilaktikrari
lgllpfteklvrk

Timeline for d2e5lr1:

• d2e5lr1 first appeared in SCOP 1.73
  
• d2e5lr1 appears in SCOPe 2.02
  
• d2e5lr1 appears in SCOPe 2.04
  
• d2e5lr1 appears in the current release, SCOPe 2.08