SCOPe 2.01: Domain d2e5lo1: 2e5l O:2-89

Lineage for d2e5lo1 (2e5l O:2-89)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily)
   3 helices; irregular array

4. Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (3 families)

5. Family a.16.1.2: Ribosomal protein S15 [47064] (1 protein)
   contains additional N-terminal helix that forms a separate unit

6. Protein Ribosomal protein S15 [47065] (3 species)

7. Species Thermus thermophilus [TaxId:274] [47067] (42 PDB entries)
   Uniprot P80378

8. Domain d2e5lo1: 2e5l O:2-89 [132039]
   Other proteins in same PDB: d2e5lc1, d2e5lc2, d2e5ld1, d2e5le1, d2e5le2, d2e5lf1, d2e5lg1, d2e5lh1, d2e5li1, d2e5lj1, d2e5lk1, d2e5ll1, d2e5lm1, d2e5ln1, d2e5lp1, d2e5lq1, d2e5lr1, d2e5ls1, d2e5lt1, d2e5lv1
   automatically matched to d1ab3__
   complexed with zn

Details for d2e5lo1

PDB Entry: 2e5l, 3.3 Å

PDB Description: a snapshot of the 30s ribosomal subunit capturing mrna via the shine- dalgarno interaction

PDB Compounds: (O:) 30S ribosomal protein S15

SCOPe Domain Sequences for d2e5lo1:

Sequence; same for both SEQRES and ATOM records:

>d2e5lo1 a.16.1.2 (O:2-89) Ribosomal protein S15 {Thermus thermophilus [TaxId: 274]}
pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg
qrrrllrylqredperyralieklgirg

Timeline for d2e5lo1:

• d2e5lo1 first appeared in SCOP 1.73
  
• d2e5lo1 appears in SCOP 1.75
  
• d2e5lo1 appears in SCOPe 2.02
  
• d2e5lo1 appears in the current release, SCOPe 2.08