Lineage for d2e5ln1 (2e5l N:2-61)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 750235Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 750236Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (15 families) (S)
  5. 750502Family g.39.1.7: Ribosomal protein S14 [57752] (1 protein)
  6. 750503Protein Ribosomal protein S14 [57753] (1 species)
  7. 750504Species Thermus thermophilus [TaxId:274] [57754] (36 PDB entries)
  8. 750527Domain d2e5ln1: 2e5l N:2-61 [132038]
    Other proteins in same PDB: d2e5lc1, d2e5lc2, d2e5ld1, d2e5le1, d2e5le2, d2e5lf1, d2e5lg1, d2e5lh1, d2e5li1, d2e5lj1, d2e5lk1, d2e5ll1, d2e5lm1, d2e5lo1, d2e5lp1, d2e5lq1, d2e5lr1, d2e5ls1, d2e5lt1
    automatically matched to d1fjgn_
    complexed with zn

Details for d2e5ln1

PDB Entry: 2e5l (more details), 3.3 Å

PDB Description: a snapshot of the 30s ribosomal subunit capturing mrna via the shine- dalgarno interaction
PDB Compounds: (N:) 30S ribosomal protein S14

SCOP Domain Sequences for d2e5ln1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e5ln1 g.39.1.7 (N:2-61) Ribosomal protein S14 {Thermus thermophilus [TaxId: 274]}
arkaliekakrtpkfkvraytrcvrcgrarsvyrffglcriclrelahkgqlpgvrkasw

SCOP Domain Coordinates for d2e5ln1:

Click to download the PDB-style file with coordinates for d2e5ln1.
(The format of our PDB-style files is described here.)

Timeline for d2e5ln1: