SCOPe 2.03: Domain d2e5ll1: 2e5l L:5-122

Lineage for d2e5ll1 (2e5l L:5-122)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families)

5. Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins)
   barrel, closed; n=5, S=8

6. Protein Ribosomal protein S12 [50302] (2 species)

7. Species Thermus thermophilus [TaxId:274] [50303] (36 PDB entries)
   Uniprot P17293

8. Domain d2e5ll1: 2e5l L:5-122 [132036]
   Other proteins in same PDB: d2e5lc1, d2e5lc2, d2e5ld1, d2e5le1, d2e5le2, d2e5lf1, d2e5lg1, d2e5lh1, d2e5li1, d2e5lj1, d2e5lk1, d2e5lm1, d2e5ln1, d2e5lo1, d2e5lp1, d2e5lq1, d2e5lr1, d2e5ls1, d2e5lt1, d2e5lv1
   automatically matched to d1i94l_
   complexed with zn

Details for d2e5ll1

PDB Entry: 2e5l, 3.3 Å

PDB Description: a snapshot of the 30s ribosomal subunit capturing mrna via the shine- dalgarno interaction

PDB Compounds: (L:) 30S ribosomal protein S12

SCOPe Domain Sequences for d2e5ll1:

Sequence; same for both SEQRES and ATOM records:

>d2e5ll1 b.40.4.5 (L:5-122) Ribosomal protein S12 {Thermus thermophilus [TaxId: 274]}
ptinqlvrkgrekvrkkskvpalkgapfrrgvctvvrtvtpkkpnsalrkvakvrltsgy
evtayipgeghnlqehsvvlirggrvkdlpgvryhivrgvydaagvkdrkksrskygt

Timeline for d2e5ll1:

• d2e5ll1 first appeared in SCOP 1.73
  
• d2e5ll1 appears in SCOPe 2.02
  
• d2e5ll1 appears in SCOPe 2.04
  
• d2e5ll1 appears in the current release, SCOPe 2.08