SCOPe 2.04: Domain d2e5lk1: 2e5l K:11-125

Lineage for d2e5lk1 (2e5l K:11-125)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.4: Translational machinery components [53137] (3 families)

5. Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins)

6. Protein Ribosomal protein S11 [53141] (2 species)

7. Species Thermus thermophilus [TaxId:274] [53142] (46 PDB entries)
   Uniprot P80376

8. Domain d2e5lk1: 2e5l K:11-125 [132035]
   Other proteins in same PDB: d2e5lc1, d2e5lc2, d2e5ld1, d2e5le1, d2e5le2, d2e5lf1, d2e5lg1, d2e5lh1, d2e5li1, d2e5lj1, d2e5ll1, d2e5lm1, d2e5ln1, d2e5lo1, d2e5lp1, d2e5lq1, d2e5lr1, d2e5ls1, d2e5lt1, d2e5lv1
   automatically matched to d1i94k_
   complexed with zn

Details for d2e5lk1

PDB Entry: 2e5l, 3.3 Å

PDB Description: a snapshot of the 30s ribosomal subunit capturing mrna via the shine- dalgarno interaction

PDB Compounds: (K:) 30S ribosomal protein S11

SCOPe Domain Sequences for d2e5lk1:

Sequence; same for both SEQRES and ATOM records:

>d2e5lk1 c.55.4.1 (K:11-125) Ribosomal protein S11 {Thermus thermophilus [TaxId: 274]}
krqvasgrayihasynntivtitdpdgnpitwssggvigykgsrkgtpyaaqlaaldaak
kamaygmqsvdvivrgtgagreqairalqasglqvksivddtpvphngcrpkkkf

Timeline for d2e5lk1:

• d2e5lk1 first appeared in SCOP 1.73
  
• d2e5lk1 appears in SCOPe 2.03
  
• d2e5lk1 appears in SCOPe 2.05
  
• d2e5lk1 appears in the current release, SCOPe 2.08