SCOP 1.73: Domain d2e5lj1: 2e5l J:3-100

Lineage for d2e5lj1 (2e5l J:3-100)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.15: Ribosomal protein S10 [54999] (1 family)

5. Family d.58.15.1: Ribosomal protein S10 [55000] (1 protein)

6. Protein Ribosomal protein S10 [55001] (1 species)

7. Species Thermus thermophilus [TaxId:274] [55002] (36 PDB entries)

8. Domain d2e5lj1: 2e5l J:3-100 [132034]
   Other proteins in same PDB: d2e5lc1, d2e5lc2, d2e5ld1, d2e5le1, d2e5le2, d2e5lf1, d2e5lg1, d2e5lh1, d2e5li1, d2e5lk1, d2e5ll1, d2e5lm1, d2e5ln1, d2e5lo1, d2e5lp1, d2e5lq1, d2e5lr1, d2e5ls1, d2e5lt1
   automatically matched to d1fjgj_
   complexed with zn

Details for d2e5lj1

PDB Entry: 2e5l, 3.3 Å

PDB Description: a snapshot of the 30s ribosomal subunit capturing mrna via the shine- dalgarno interaction

PDB Compounds: (J:) 30S ribosomal protein S10

SCOP Domain Sequences for d2e5lj1:

Sequence; same for both SEQRES and ATOM records:

>d2e5lj1 d.58.15.1 (J:3-100) Ribosomal protein S10 {Thermus thermophilus [TaxId: 274]}
kiriklrgfdhktldasaqkiveaarrsgaqvsgpiplptrvrrftvirgpfkhkdsreh
felrthnrlvdiinpnrktieqlmtldlptgveieikt

Timeline for d2e5lj1:

• d2e5lj1 is new in SCOP 1.73
  
• d2e5lj1 appears in SCOP 1.75
  
• d2e5lj1 appears in the current release, SCOPe 2.08