SCOPe 2.06: Domain d2e5lh1: 2e5l H:1-138

Lineage for d2e5lh1 (2e5l H:1-138)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.140: Ribosomal protein S8 [56046] (1 superfamily)
   consists of 2 different alpha+beta subdomains arranged in a 4-layer structure: b/a/b/a

4. Superfamily d.140.1: Ribosomal protein S8 [56047] (1 family)
   automatically mapped to Pfam PF00410

5. Family d.140.1.1: Ribosomal protein S8 [56048] (1 protein)

6. Protein Ribosomal protein S8 [56049] (4 species)

7. Species Thermus thermophilus [TaxId:274] [56051] (46 PDB entries)
   Uniprot P24319

8. Domain d2e5lh1: 2e5l H:1-138 [132032]
   Other proteins in same PDB: d2e5lc1, d2e5lc2, d2e5ld1, d2e5le1, d2e5le2, d2e5lf1, d2e5lg1, d2e5li1, d2e5lj1, d2e5lk1, d2e5ll1, d2e5lm1, d2e5ln1, d2e5lo1, d2e5lp1, d2e5lq1, d2e5lr1, d2e5ls1, d2e5lt1, d2e5lv1
   automatically matched to d1fjgh_
   complexed with zn

Details for d2e5lh1

PDB Entry: 2e5l, 3.3 Å

PDB Description: a snapshot of the 30s ribosomal subunit capturing mrna via the shine- dalgarno interaction

PDB Compounds: (H:) 30S ribosomal protein S8

SCOPe Domain Sequences for d2e5lh1:

Sequence; same for both SEQRES and ATOM records:

>d2e5lh1 d.140.1.1 (H:1-138) Ribosomal protein S8 {Thermus thermophilus [TaxId: 274]}
mltdpiadmltrirnatrvykestdvpasrfkeeilrilaregfikgyervdvdgkpylr
vylkygprrqgpdprpeqvihhirriskpgrrvyvgvkeiprvrrglgiailstskgvlt
drearklgvggelicevw

Timeline for d2e5lh1:

• d2e5lh1 first appeared in SCOP 1.73
  
• d2e5lh1 appears in SCOPe 2.05
  
• d2e5lh1 appears in SCOPe 2.07
  
• d2e5lh1 appears in the current release, SCOPe 2.08