Lineage for d2e5lh1 (2e5l H:1-138)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1219328Fold d.140: Ribosomal protein S8 [56046] (1 superfamily)
    consists of 2 different alpha+beta subdomains arranged in a 4-layer structure: b/a/b/a
  4. 1219329Superfamily d.140.1: Ribosomal protein S8 [56047] (1 family) (S)
  5. 1219330Family d.140.1.1: Ribosomal protein S8 [56048] (1 protein)
  6. 1219331Protein Ribosomal protein S8 [56049] (4 species)
  7. 1219349Species Thermus thermophilus [TaxId:274] [56051] (46 PDB entries)
    Uniprot P24319
  8. 1219375Domain d2e5lh1: 2e5l H:1-138 [132032]
    Other proteins in same PDB: d2e5lc1, d2e5lc2, d2e5ld1, d2e5le1, d2e5le2, d2e5lf1, d2e5lg1, d2e5li1, d2e5lj1, d2e5lk1, d2e5ll1, d2e5lm1, d2e5ln1, d2e5lo1, d2e5lp1, d2e5lq1, d2e5lr1, d2e5ls1, d2e5lt1, d2e5lv1
    automatically matched to d1fjgh_
    complexed with zn

Details for d2e5lh1

PDB Entry: 2e5l (more details), 3.3 Å

PDB Description: a snapshot of the 30s ribosomal subunit capturing mrna via the shine- dalgarno interaction
PDB Compounds: (H:) 30S ribosomal protein S8

SCOPe Domain Sequences for d2e5lh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e5lh1 d.140.1.1 (H:1-138) Ribosomal protein S8 {Thermus thermophilus [TaxId: 274]}
mltdpiadmltrirnatrvykestdvpasrfkeeilrilaregfikgyervdvdgkpylr
vylkygprrqgpdprpeqvihhirriskpgrrvyvgvkeiprvrrglgiailstskgvlt
drearklgvggelicevw

SCOPe Domain Coordinates for d2e5lh1:

Click to download the PDB-style file with coordinates for d2e5lh1.
(The format of our PDB-style files is described here.)

Timeline for d2e5lh1: