SCOPe 2.03: Domain d2e5lf1: 2e5l F:1-101

Lineage for d2e5lf1 (2e5l F:1-101)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.14: Ribosomal protein S6 [54995] (1 family)

5. Family d.58.14.1: Ribosomal protein S6 [54996] (1 protein)

6. Protein Ribosomal protein S6 [54997] (4 species)

7. Species Thermus thermophilus [TaxId:274] [54998] (53 PDB entries)
   Uniprot P23370

8. Domain d2e5lf1: 2e5l F:1-101 [132030]
   Other proteins in same PDB: d2e5lc1, d2e5lc2, d2e5ld1, d2e5le1, d2e5le2, d2e5lg1, d2e5lh1, d2e5li1, d2e5lj1, d2e5lk1, d2e5ll1, d2e5lm1, d2e5ln1, d2e5lo1, d2e5lp1, d2e5lq1, d2e5lr1, d2e5ls1, d2e5lt1, d2e5lv1
   automatically matched to d1fjgf_
   complexed with zn

Details for d2e5lf1

PDB Entry: 2e5l, 3.3 Å

PDB Description: a snapshot of the 30s ribosomal subunit capturing mrna via the shine- dalgarno interaction

PDB Compounds: (F:) 30S ribosomal protein S6

SCOPe Domain Sequences for d2e5lf1:

Sequence; same for both SEQRES and ATOM records:

>d2e5lf1 d.58.14.1 (F:1-101) Ribosomal protein S6 {Thermus thermophilus [TaxId: 274]}
mrryevnivlnpnldqsqlalekeiiqralenygarvekveelglrrlaypiakdpqgyf
lwyqvempedrvndlarelrirdnvrrvmvvksqepflana

Timeline for d2e5lf1:

• d2e5lf1 first appeared in SCOP 1.73
  
• d2e5lf1 appears in SCOPe 2.02
  
• d2e5lf1 appears in SCOPe 2.04
  
• d2e5lf1 appears in the current release, SCOPe 2.08