Lineage for d2e5ld1 (2e5l D:2-209)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1419099Fold d.66: Alpha-L RNA-binding motif [55173] (1 superfamily)
    alpha(2)-beta(2)-loop-beta; 2 layers: alpha/beta
  4. 1419100Superfamily d.66.1: Alpha-L RNA-binding motif [55174] (5 families) (S)
    common motif in otherwise different folds
  5. 1419101Family d.66.1.2: Ribosomal protein S4 [55178] (1 protein)
    has a RRF/tRNA synthetase additional domain-like fold
  6. 1419102Protein Ribosomal protein S4 [55179] (3 species)
    also contains a Zn-binding N-terminal subdomain
  7. 1419133Species Thermus thermophilus [TaxId:274] [55180] (45 PDB entries)
  8. 1419158Domain d2e5ld1: 2e5l D:2-209 [132027]
    Other proteins in same PDB: d2e5lc1, d2e5lc2, d2e5le1, d2e5le2, d2e5lf1, d2e5lg1, d2e5lh1, d2e5li1, d2e5lj1, d2e5lk1, d2e5ll1, d2e5lm1, d2e5ln1, d2e5lo1, d2e5lp1, d2e5lq1, d2e5lr1, d2e5ls1, d2e5lt1, d2e5lv1
    automatically matched to d1hnwd_
    complexed with zn

Details for d2e5ld1

PDB Entry: 2e5l (more details), 3.3 Å

PDB Description: a snapshot of the 30s ribosomal subunit capturing mrna via the shine- dalgarno interaction
PDB Compounds: (D:) 30S ribosomal protein S4

SCOPe Domain Sequences for d2e5ld1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e5ld1 d.66.1.2 (D:2-209) Ribosomal protein S4 {Thermus thermophilus [TaxId: 274]}
gryigpvcrlcrregvklylkgercyspkcamerrpyppgqhgqkrarrpsdyavrlrek
qklrriygiserqfrnlfeeaskkkgvtgsvflgllesrldnvvyrlgfavsrrqarqlv
rhghitvngrrvdlpsyrvrpgdeiavaeksrnlelirqnleamkgrkvgpwlsldvegm
kgkflrlpdredlalpvneqlviefysr

SCOPe Domain Coordinates for d2e5ld1:

Click to download the PDB-style file with coordinates for d2e5ld1.
(The format of our PDB-style files is described here.)

Timeline for d2e5ld1: