SCOPe 2.07: Domain d2e3ba_: 2e3b A:

Lineage for d2e3ba_ (2e3b A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families)

5. Family a.93.1.1: CCP-like [48114] (5 proteins)

6. Protein Fungal peroxidase (ligninase) [88935] (3 species)

7. Species Arthromyces ramosus [TaxId:5451] [48118] (14 PDB entries)

8. Domain d2e3ba_: 2e3b A: [132024]
   automated match to d1arva_
   complexed with ca, hem, hoa, man, nag

Details for d2e3ba_

PDB Entry: 2e3b, 1.3 Å

PDB Description: crystal structure of the ha-bound form of arthromyces ramosus peroxidase at 1.3 angstroms resolution

PDB Compounds: (A:) Peroxidase

SCOPe Domain Sequences for d2e3ba_:

Sequence; same for both SEQRES and ATOM records:

>d2e3ba_ a.93.1.1 (A:) Fungal peroxidase (ligninase) {Arthromyces ramosus [TaxId: 5451]}
svtcpggqstsnsqccvwfdvlddlqtnfyqgskcespvrkilrivfhdaigfspaltaa
gqfggggadgsiiahsnielafpanggltdtiealravginhgvsfgdliqfatavgmsn
cpgsprlefltgrsnssqpsppslipgpgntvtaildrmgdagfspdevvdllaahslas
qeglnsaifrspldstpqvfdtqfyietllkgttqpgpslgfaeelspfpgefrmrsdal
lardsrtacrwqsmtssnevmgqryraamakmsvlgfdrnaltdcsdvipsavsnnaapv
ipggltvddievscpsepfpeiatasgplpslapap

Timeline for d2e3ba_:

• d2e3ba_ first appeared in SCOP 1.73, called d2e3ba1
  
• d2e3ba_ appears in SCOPe 2.06
  
• d2e3ba_ appears in the current release, SCOPe 2.08