Lineage for d2e39a1 (2e39 A:9-344)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 773241Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 773242Superfamily a.93.1: Heme-dependent peroxidases [48113] (3 families) (S)
  5. 773243Family a.93.1.1: CCP-like [48114] (4 proteins)
  6. 773392Protein Fungal peroxidase (ligninase) [88935] (4 species)
  7. 773393Species Arthromyces ramosus [TaxId:5451] [48118] (14 PDB entries)
  8. 773394Domain d2e39a1: 2e39 A:9-344 [132022]
    automatically matched to d1arp__
    complexed with ca, cyn, hem, man, nag

Details for d2e39a1

PDB Entry: 2e39 (more details), 1.3 Å

PDB Description: crystal structure of the cn-bound form of arthromyces ramosus peroxidase at 1.3 angstroms resolution
PDB Compounds: (A:) Peroxidase

SCOP Domain Sequences for d2e39a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e39a1 a.93.1.1 (A:9-344) Fungal peroxidase (ligninase) {Arthromyces ramosus [TaxId: 5451]}
svtcpggqstsnsqccvwfdvlddlqtnfyqgskcespvrkilrivfhdaigfspaltaa
gqfggggadgsiiahsnielafpanggltdtiealravginhgvsfgdliqfatavgmsn
cpgsprlefltgrsnssqpsppslipgpgntvtaildrmgdagfspdevvdllaahslas
qeglnsaifrspldstpqvfdtqfyietllkgttqpgpslgfaeelspfpgefrmrsdal
lardsrtacrwqsmtssnevmgqryraamakmsvlgfdrnaltdcsdvipsavsnnaapv
ipggltvddievscpsepfpeiatasgplpslapap

SCOP Domain Coordinates for d2e39a1:

Click to download the PDB-style file with coordinates for d2e39a1.
(The format of our PDB-style files is described here.)

Timeline for d2e39a1: