Lineage for d2e33b1 (2e33 B:21-124)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 715752Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 715753Superfamily d.5.1: RNase A-like [54076] (1 family) (S)
    can be classified as disulfide-rich
  5. 715754Family d.5.1.1: Ribonuclease A-like [54077] (8 proteins)
  6. 715828Protein Ribonuclease A (also ribonuclease B, S) [54078] (3 species)
  7. 715829Species Cow (Bos taurus) [TaxId:9913] [54079] (142 PDB entries)
  8. 716004Domain d2e33b1: 2e33 B:21-124 [132021]
    Other proteins in same PDB: d2e33a1
    automatically matched to d1rbc__
    complexed with bma, man, nag

Details for d2e33b1

PDB Entry: 2e33 (more details), 2.7 Å

PDB Description: structural basis for selection of glycosylated substrate by scffbs1 ubiquitin ligase
PDB Compounds: (B:) ribonuclease pancreatic

SCOP Domain Sequences for d2e33b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e33b1 d.5.1.1 (B:21-124) Ribonuclease A (also ribonuclease B, S) {Cow (Bos taurus) [TaxId: 9913]}
sssnycnqmmksrnltkdrckpvntfvhesladvqavcsqknvackngqtncyqsystms
itdcretgsskypncaykttqankhiivacegnpyvpvhfdasv

SCOP Domain Coordinates for d2e33b1:

Click to download the PDB-style file with coordinates for d2e33b1.
(The format of our PDB-style files is described here.)

Timeline for d2e33b1: