Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.5: RNase A-like [54075] (1 superfamily) contains long curved beta-sheet and 3 helices |
Superfamily d.5.1: RNase A-like [54076] (1 family) can be classified as disulfide-rich |
Family d.5.1.1: Ribonuclease A-like [54077] (8 proteins) |
Protein Ribonuclease A (also ribonuclease B, S) [54078] (3 species) |
Species Cow (Bos taurus) [TaxId:9913] [54079] (142 PDB entries) |
Domain d2e33b1: 2e33 B:21-124 [132021] Other proteins in same PDB: d2e33a1 automatically matched to d1rbc__ complexed with bma, man, nag |
PDB Entry: 2e33 (more details), 2.7 Å
SCOP Domain Sequences for d2e33b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2e33b1 d.5.1.1 (B:21-124) Ribonuclease A (also ribonuclease B, S) {Cow (Bos taurus) [TaxId: 9913]} sssnycnqmmksrnltkdrckpvntfvhesladvqavcsqknvackngqtncyqsystms itdcretgsskypncaykttqankhiivacegnpyvpvhfdasv
Timeline for d2e33b1: