Lineage for d2e2jj1 (2e2j J:1-65)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981563Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1985075Superfamily a.4.11: RNA polymerase subunit RPB10 [46924] (1 family) (S)
    automatically mapped to Pfam PF01194
  5. 1985076Family a.4.11.1: RNA polymerase subunit RPB10 [46925] (2 proteins)
    Zn-binding site is near the N-terminus
  6. 1985077Protein RNA polymerase subunit RPB10 [46926] (3 species)
  7. 1985078Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63490] (28 PDB entries)
    Uniprot P22139; part of multichain biological unit
  8. 1985095Domain d2e2jj1: 2e2j J:1-65 [132017]
    Other proteins in same PDB: d2e2ja1, d2e2jb1, d2e2jc1, d2e2jc2, d2e2je1, d2e2je2, d2e2jf1, d2e2jh1, d2e2ji1, d2e2ji2, d2e2jk1, d2e2jl1
    automatically matched to d1i3qj_
    protein/DNA complex; protein/RNA complex; complexed with g2p, mg, zn

Details for d2e2jj1

PDB Entry: 2e2j (more details), 3.5 Å

PDB Description: rna polymerase ii elongation complex in 5 mm mg+2 with gmpcpp
PDB Compounds: (J:) DNA-directed RNA polymerases I/II/III subunit 10

SCOPe Domain Sequences for d2e2jj1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e2jj1 a.4.11.1 (J:1-65) RNA polymerase subunit RPB10 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mivpvrcfscgkvvgdkwesylnllqedeldegtalsrlglkryccrrmilthvdliekf
lrynp

SCOPe Domain Coordinates for d2e2jj1:

Click to download the PDB-style file with coordinates for d2e2jj1.
(The format of our PDB-style files is described here.)

Timeline for d2e2jj1: