SCOP 1.73: Domain d2e2ji1: 2e2j I:2-49

Lineage for d2e2ji1 (2e2j I:2-49)

1. Root: SCOP 1.73

2. Class g: Small proteins [56992] (85 folds)

3. Fold g.41: Rubredoxin-like [57769] (16 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.3: Zinc beta-ribbon [57783] (5 families)

5. Family g.41.3.1: Transcriptional factor domain [57784] (4 proteins)

6. Protein RBP9 subunit of RNA polymerase II [57787] (2 species)
   contains two differently decorated domains of this fold

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64575] (24 PDB entries)

8. Domain d2e2ji1: 2e2j I:2-49 [132015]
   Other proteins in same PDB: d2e2ja1, d2e2jb1, d2e2jc1, d2e2jc2, d2e2je1, d2e2je2, d2e2jf1, d2e2jh1, d2e2jj1, d2e2jk1, d2e2jl1
   automatically matched to d1i3qi1
   complexed with g2p, mg, zn

Details for d2e2ji1

PDB Entry: 2e2j, 3.5 Å

PDB Description: rna polymerase ii elongation complex in 5 mm mg+2 with gmpcpp

PDB Compounds: (I:) DNA-directed RNA polymerase II subunit 9

SCOP Domain Sequences for d2e2ji1:

Sequence; same for both SEQRES and ATOM records:

>d2e2ji1 g.41.3.1 (I:2-49) RBP9 subunit of RNA polymerase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ttfrfcrdcnnmlypredkennrllfecrtcsyveeagsplvyrheli

Timeline for d2e2ji1:

• d2e2ji1 is new in SCOP 1.73
  
• d2e2ji1 appears in SCOP 1.75
  
• d2e2ji1 appears in the current release, SCOPe 2.08