Lineage for d2e2if1 (2e2i F:72-155)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 778858Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily)
    core: 2 helices and adjacent loops
  4. 778859Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families) (S)
    the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits
  5. 778888Family a.143.1.2: RPB6 [55294] (1 protein)
  6. 778889Protein RPB6 [55295] (2 species)
    essential subunit of RNA polymerases I, II and III
  7. 778890Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64318] (29 PDB entries)
    Uniprot P20435; part of multichain biological unit
  8. 778906Domain d2e2if1: 2e2i F:72-155 [132000]
    Other proteins in same PDB: d2e2ia1, d2e2ib1, d2e2ic1, d2e2ic2, d2e2ie1, d2e2ie2, d2e2ih1, d2e2ii1, d2e2ii2, d2e2ij1, d2e2ik1, d2e2il1
    automatically matched to d1i3qf_
    complexed with dgt, mg, zn

Details for d2e2if1

PDB Entry: 2e2i (more details), 3.41 Å

PDB Description: RNA polymerase II elongation complex in 5 mM Mg+2 with 2'-dGTP
PDB Compounds: (F:) DNA-directed RNA polymerases I, II, and III 23 kDa polypeptide

SCOP Domain Sequences for d2e2if1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e2if1 a.143.1.2 (F:72-155) RPB6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kaipkdqrattpymtkyerarilgtralqismnapvfvdlegetdplriamkelaekkip
lvirrylpdgsfedwsveelivdl

SCOP Domain Coordinates for d2e2if1:

Click to download the PDB-style file with coordinates for d2e2if1.
(The format of our PDB-style files is described here.)

Timeline for d2e2if1: