Lineage for d2e2ie2 (2e2i E:144-215)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1209496Fold d.78: RPB5-like RNA polymerase subunit [55286] (1 superfamily)
    core: beta-alpha-beta-alpha-beta(2); 2 layers, alpha/beta
  4. 1209497Superfamily d.78.1: RPB5-like RNA polymerase subunit [55287] (1 family) (S)
  5. 1209498Family d.78.1.1: RPB5 [55288] (2 proteins)
  6. 1209499Protein Eukaryotic RPB5 C-terminal domain [55292] (1 species)
  7. 1209500Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55293] (25 PDB entries)
    Uniprot P20434; part of multichain biological unit
  8. 1209513Domain d2e2ie2: 2e2i E:144-215 [131999]
    Other proteins in same PDB: d2e2ia1, d2e2ib1, d2e2ic1, d2e2ic2, d2e2ie1, d2e2if1, d2e2ih1, d2e2ii1, d2e2ii2, d2e2ij1, d2e2ik1, d2e2il1
    automatically matched to d1dzfa2
    protein/DNA complex; protein/RNA complex; complexed with dgt, mg, zn

Details for d2e2ie2

PDB Entry: 2e2i (more details), 3.41 Å

PDB Description: RNA polymerase II elongation complex in 5 mM Mg+2 with 2'-dGTP
PDB Compounds: (E:) DNA-directed RNA polymerases I, II, and III 27 kDa polypeptide

SCOPe Domain Sequences for d2e2ie2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e2ie2 d.78.1.1 (E:144-215) Eukaryotic RPB5 C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ithhelvpkhirlssdekrellkryrlkesqlpriqradpvalylglkrgevvkiirkse
tsgryasyricm

SCOPe Domain Coordinates for d2e2ie2:

Click to download the PDB-style file with coordinates for d2e2ie2.
(The format of our PDB-style files is described here.)

Timeline for d2e2ie2: