SCOP 1.75: Domain d2e2he1: 2e2h E:3-143

Lineage for d2e2he1 (2e2h E:3-143)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest

4. Superfamily c.52.3: Eukaryotic RPB5 N-terminal domain [53036] (1 family)

5. Family c.52.3.1: Eukaryotic RPB5 N-terminal domain [53037] (1 protein)

6. Protein Eukaryotic RPB5 N-terminal domain [53038] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [53039] (25 PDB entries)
   Uniprot P20434; part of multichain biological unit

8. Domain d2e2he1: 2e2h E:3-143 [131985]
   Other proteins in same PDB: d2e2ha1, d2e2hb1, d2e2hc1, d2e2hc2, d2e2he2, d2e2hf1, d2e2hh1, d2e2hi1, d2e2hi2, d2e2hj1, d2e2hk1, d2e2hl1
   automatically matched to d1i3qe1
   complexed with gtp, mg, zn

Details for d2e2he1

PDB Entry: 2e2h, 3.95 Å

PDB Description: RNA polymerase II elongation complex at 5 mM Mg2+ with GTP

PDB Compounds: (E:) DNA-directed RNA polymerases I, II, and III 27 kDa polypeptide

SCOP Domain Sequences for d2e2he1:

Sequence, based on SEQRES records:

>d2e2he1 c.52.3.1 (E:3-143) Eukaryotic RPB5 N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
qenernisrlwrafrtvkemvkdrgyfitqeevelpledfkakycdsmgrpqrkmmsfqa
npteesiskfpdmgslwvefcdepsvgvktmktfvihiqeknfqtgifvyqnnitpsamk
lvpsippatietfneaalvvn

Sequence, based on observed residues (ATOM records):

>d2e2he1 c.52.3.1 (E:3-143) Eukaryotic RPB5 N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
qenernisrlwrafrtvkemvkdrgyfitqeevelpledfkakycdrpqrkmmsfqanpt
eesiskfpdmgslwveftfvihiqeknfqtgifvtpsamklvpsippatietfneaalvv
n

Timeline for d2e2he1:

• d2e2he1 first appeared in SCOP 1.73
  
• d2e2he1 appears in SCOPe 2.01
  
• d2e2he1 appears in the current release, SCOPe 2.08