Class b: All beta proteins [48724] (174 folds) |
Fold b.24: Hyaluronate lyase-like, C-terminal domain [49862] (1 superfamily) sandwich, 10 strands in 2 sheets; "folded meander" |
Superfamily b.24.1: Hyaluronate lyase-like, C-terminal domain [49863] (1 family) |
Family b.24.1.1: Hyaluronate lyase-like, C-terminal domain [49864] (4 proteins) |
Protein Xanthan lyase [89264] (1 species) |
Species Bacillus sp. GL1 [TaxId:84635] [89265] (7 PDB entries) |
Domain d2e24a2: 2e24 A:660-777 [131977] Other proteins in same PDB: d2e24a1, d2e24a3 automatically matched to d1j0ma2 complexed with peg; mutant |
PDB Entry: 2e24 (more details), 2.15 Å
SCOPe Domain Sequences for d2e24a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2e24a2 b.24.1.1 (A:660-777) Xanthan lyase {Bacillus sp. GL1 [TaxId: 84635]} paieivvntsgvqsvkektlglvganfwtdttqtadlitsnkkasvmtreiaderleasv sdptqanngtiaielarsaegysadpgitvtqlaptikftvnvngakgksfhasfqlg
Timeline for d2e24a2: