Lineage for d2e24a2 (2e24 A:660-777)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1306780Fold b.24: Hyaluronate lyase-like, C-terminal domain [49862] (1 superfamily)
    sandwich, 10 strands in 2 sheets; "folded meander"
  4. 1306781Superfamily b.24.1: Hyaluronate lyase-like, C-terminal domain [49863] (1 family) (S)
  5. 1306782Family b.24.1.1: Hyaluronate lyase-like, C-terminal domain [49864] (4 proteins)
  6. 1306825Protein Xanthan lyase [89264] (1 species)
  7. 1306826Species Bacillus sp. GL1 [TaxId:84635] [89265] (7 PDB entries)
  8. 1306829Domain d2e24a2: 2e24 A:660-777 [131977]
    Other proteins in same PDB: d2e24a1, d2e24a3
    automatically matched to d1j0ma2
    complexed with peg; mutant

Details for d2e24a2

PDB Entry: 2e24 (more details), 2.15 Å

PDB Description: crystal structure of a mutant (r612a) of xanthan lyase
PDB Compounds: (A:) xanthan lyase

SCOPe Domain Sequences for d2e24a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e24a2 b.24.1.1 (A:660-777) Xanthan lyase {Bacillus sp. GL1 [TaxId: 84635]}
paieivvntsgvqsvkektlglvganfwtdttqtadlitsnkkasvmtreiaderleasv
sdptqanngtiaielarsaegysadpgitvtqlaptikftvnvngakgksfhasfqlg

SCOPe Domain Coordinates for d2e24a2:

Click to download the PDB-style file with coordinates for d2e24a2.
(The format of our PDB-style files is described here.)

Timeline for d2e24a2: