Lineage for d2e22a1 (2e22 A:26-386)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 645795Fold a.102: alpha/alpha toroid [48207] (5 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 645968Superfamily a.102.3: Chondroitin AC/alginate lyase [48230] (2 families) (S)
    incomplete toroid
  5. 645974Family a.102.3.2: Hyaluronate lyase-like catalytic, N-terminal domain [48234] (4 proteins)
  6. 646017Protein Xanthan lyase [89111] (1 species)
  7. 646018Species Bacillus sp. gl1 [TaxId:84635] [89112] (7 PDB entries)
  8. 646023Domain d2e22a1: 2e22 A:26-386 [131973]
    Other proteins in same PDB: d2e22a2, d2e22a3
    automatically matched to d1j0ma1
    complexed with man

Details for d2e22a1

PDB Entry: 2e22 (more details), 2.4 Å

PDB Description: crystal structure of xanthan lyase in complex with mannose
PDB Compounds: (A:) xanthan lyase

SCOP Domain Sequences for d2e22a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e22a1 a.102.3.2 (A:26-386) Xanthan lyase {Bacillus sp. gl1 [TaxId: 84635]}
sdefdalrikwatlltggpaldpadsdiaartdklaqdandywedmdlsssrtyiwyalr
gngtsdnvnavyerlrtmalaattvgsslygnadlkedildaldwlyvnsynstrsrsay
nwwhwqlgipmslndiavllyddisaarmatymdtidyftpsigltganrawqaivvgvr
avivkdavklaaarnglsgtgifpyatggdgfyadgsfvqhttfaytggygssvlettan
lmyllsgstwsvsdpnqsnvwqwiyeayrpllykgammdmvrgreisrsyaqdhavghgi
vasivrlaqfapaphaaafkqiakrviqedtfssfygdvstdtirlakaivddpsiapaa
a

SCOP Domain Coordinates for d2e22a1:

Click to download the PDB-style file with coordinates for d2e22a1.
(The format of our PDB-style files is described here.)

Timeline for d2e22a1: