SCOPe 2.04: Domain d2e1ra5: 2e1r A:726-842

Lineage for d2e1ra5 (2e1r A:726-842)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.11: EF-G C-terminal domain-like [54980] (4 families)

5. Family d.58.11.0: automated matches [254210] (1 protein)
   not a true family

6. Protein automated matches [254469] (2 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255012] (4 PDB entries)

8. Domain d2e1ra5: 2e1r A:726-842 [131970]
   Other proteins in same PDB: d2e1ra1, d2e1ra2, d2e1ra3
   automated match to d1n0ua5
   complexed with gdp, sod

Details for d2e1ra5

PDB Entry: 2e1r, 3.15 Å

PDB Description: structure of eef2 in complex with a sordarin derivative

PDB Compounds: (A:) Elongation factor 2

SCOPe Domain Sequences for d2e1ra5:

Sequence; same for both SEQRES and ATOM records:

>d2e1ra5 d.58.11.0 (A:726-842) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
epvflveiqcpeqavggiysvlnkkrgqvvseeqrpgtplftvkaylpvnesfgftgelr
qatggqafpqmvfdhwstlgsdpldptskageivlaarkrhgmkeevpgwqeyydkl

Timeline for d2e1ra5:

• d2e1ra5 first appeared in SCOP 1.73
  
• d2e1ra5 appears in SCOPe 2.03
  
• d2e1ra5 appears in SCOPe 2.05
  
• d2e1ra5 appears in the current release, SCOPe 2.08