Lineage for d2e1ra3 (2e1r A:561-725)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1636635Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 1636636Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 1637334Family d.14.1.0: automated matches [191504] (1 protein)
    not a true family
  6. 1637335Protein automated matches [190826] (16 species)
    not a true protein
  7. 1637370Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255013] (5 PDB entries)
  8. 1637375Domain d2e1ra3: 2e1r A:561-725 [131968]
    Other proteins in same PDB: d2e1ra1, d2e1ra2, d2e1ra4, d2e1ra5
    automated match to d1n0ua3
    complexed with gdp, sod

Details for d2e1ra3

PDB Entry: 2e1r (more details), 3.15 Å

PDB Description: structure of eef2 in complex with a sordarin derivative
PDB Compounds: (A:) Elongation factor 2

SCOPe Domain Sequences for d2e1ra3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e1ra3 d.14.1.0 (A:561-725) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vayretvesessqtalskspnkhnriylkaepideevslaiengiinprddfkararima
ddygwdvtdarkiwcfgpdgngpnlvidqtkavqylheikdsvvaafqwatkegpifgee
mrsvrvnildvtlhadaihrgggqiiptmrratyagflladpkiq

SCOPe Domain Coordinates for d2e1ra3:

Click to download the PDB-style file with coordinates for d2e1ra3.
(The format of our PDB-style files is described here.)

Timeline for d2e1ra3: